Lineage for d1xyfb2 (1xyf B:501-803)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816176Protein Xylanase A, catalytic core [51514] (8 species)
  7. 816227Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    Uniprot Q7SI98
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 816233Domain d1xyfb2: 1xyf B:501-803 [28910]
    Other proteins in same PDB: d1xyfa1, d1xyfb1

Details for d1xyfb2

PDB Entry: 1xyf (more details), 1.9 Å

PDB Description: endo-1,4-beta-xylanase from streptomyces olivaceoviridis
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOP Domain Sequences for d1xyfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xyfb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1xyfb2:

Click to download the PDB-style file with coordinates for d1xyfb2.
(The format of our PDB-style files is described here.)

Timeline for d1xyfb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xyfb1