Lineage for d1tux__ (1tux -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.3: beta-glycanases [51487] (14 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) Species Thermoascus aurantiacus [TaxId:5087] [51518] (4 PDB entries) 
Domain d1tux__: 1tux - [28907]
Details for d1tux__
PDB Entry: 1tux (more details), 1.8 Å
PDB Description: high resolution crystal structure of a thermostable xylanase from thermoascus aurantiacus
SCOP Domain Sequences for d1tux__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tux__ c.1.8.3 (-) Xylanase A, catalytic core {Thermoascus aurantiacus}
aaaqsvdqlidargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvvsitdkntltnvmknhittimtryi
gkirawdvvneafnedgslrqtvfnnvigedyipiafrtaraadpnaklyindynldsas
kpktsaivkrvkkwraagvpidgigsqthlsagqgasidaalpnlasagtpevaiteldi
agatstdyvdvvnacldvdscigitvwgvadpdswrasttpllfdgnfnpkpaynaivql
l
SCOP Domain Coordinates for d1tux__:
Click to download the PDB-style file with coordinates for d1tux__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tux__:
- d1tux__ first appeared (with stable ids) in SCOP 1.55
- d1tux__ appears in SCOP 1.59
- d1tux__ appears in the current release, SCOPe 2.08, called d1tuxa_
View in 3D