Lineage for d1e5nb_ (1e5n B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236693Protein Xylanase A, catalytic core [51514] (6 species)
  7. 236712Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries)
  8. 236718Domain d1e5nb_: 1e5n B: [28905]
    complexed with ca, xys; mutant

Details for d1e5nb_

PDB Entry: 1e5n (more details), 3.2 Å

PDB Description: e246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose

SCOP Domain Sequences for d1e5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5nb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg

SCOP Domain Coordinates for d1e5nb_:

Click to download the PDB-style file with coordinates for d1e5nb_.
(The format of our PDB-style files is described here.)

Timeline for d1e5nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e5na_