Lineage for d1e5na_ (1e5n A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (13 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries) 
Domain d1e5na_: 1e5n A: [28904]
Details for d1e5na_
PDB Entry: 1e5n (more details), 3.2 Å
PDB Description: e246c mutant of p fluorescens subsp. cellulosa xylanase a in complex with xylopentaose
SCOP Domain Sequences for d1e5na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5na_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvvealsg
SCOP Domain Coordinates for d1e5na_:
Click to download the PDB-style file with coordinates for d1e5na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e5na_:
- d1e5na_ first appeared (with stable ids) in SCOP 1.55
- d1e5na_ appears in SCOP 1.57
- d1e5na_ appears in SCOP 1.61
- d1e5na_ appears in the current release, SCOPe 2.08
View in 3D
