Lineage for d1xys__ (1xys -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (13 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries) 
Domain d1xys__: 1xys - [28903]
Details for d1xys__
PDB Entry: 1xys (more details), 2.5 Å
PDB Description: catalytic core of xylanase a e246c mutant
SCOP Domain Sequences for d1xys__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xys__ c.1.8.3 (-) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikitcldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
SCOP Domain Coordinates for d1xys__:
Click to download the PDB-style file with coordinates for d1xys__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xys__:
- d1xys__ first appeared (with stable ids) in SCOP 1.55
- d1xys__ appears in SCOP 1.57
- d1xys__ appears in SCOP 1.61
- d1xys__ appears in the current release, SCOPe 2.08, called d1xysa_
View in 3D