SCOPe 2.04: Domain d1clxd_: 1clx D:

Lineage for d1clxd_ (1clx D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (8 species)

7. Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
   Uniprot P14768 265-610

8. Domain d1clxd_: 1clx D: [28902]
   complexed with ca

Details for d1clxd_

PDB Entry: 1clx, 1.8 Å

PDB Description: catalytic core of xylanase a

PDB Compounds: (D:) xylanase a

SCOPe Domain Sequences for d1clxd_:

Sequence; same for both SEQRES and ATOM records:

>d1clxd_ c.1.8.3 (D:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

Timeline for d1clxd_:

• d1clxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1clxd_ appears in SCOPe 2.03
  
• d1clxd_ appears in SCOPe 2.05
  
• d1clxd_ appears in the current release, SCOPe 2.08