Lineage for d1clxc_ (1clx C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340305Protein Xylanase A, catalytic core [51514] (8 species)
  7. 1340331Species Pseudomonas fluorescens [TaxId:294] [51517] (7 PDB entries)
    Uniprot P14768 265-610
  8. 1340340Domain d1clxc_: 1clx C: [28901]
    complexed with ca

Details for d1clxc_

PDB Entry: 1clx (more details), 1.8 Å

PDB Description: catalytic core of xylanase a
PDB Compounds: (C:) xylanase a

SCOPe Domain Sequences for d1clxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clxc_ c.1.8.3 (C:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOPe Domain Coordinates for d1clxc_:

Click to download the PDB-style file with coordinates for d1clxc_.
(The format of our PDB-style files is described here.)

Timeline for d1clxc_: