Lineage for d1clxc_ (1clx C:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (14 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries) 
Domain d1clxc_: 1clx C: [28901]
Details for d1clxc_
PDB Entry: 1clx (more details), 1.8 Å
PDB Description: catalytic core of xylanase a
SCOP Domain Sequences for d1clxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clxc_ c.1.8.3 (C:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals
SCOP Domain Coordinates for d1clxc_:
Click to download the PDB-style file with coordinates for d1clxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clxc_:
- d1clxc_ first appeared (with stable ids) in SCOP 1.55
- d1clxc_ appears in SCOP 1.59
- d1clxc_ appears in SCOP 1.63
- d1clxc_ appears in the current release, SCOPe 2.08
View in 3D
