Lineage for d1clxb_ (1clx B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18969Protein Xylanase A, catalytic core [51514] (6 species)
  7. 18987Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries)
  8. 18989Domain d1clxb_: 1clx B: [28900]

Details for d1clxb_

PDB Entry: 1clx (more details), 1.8 Å

PDB Description: catalytic core of xylanase a

SCOP Domain Sequences for d1clxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clxb_ c.1.8.3 (B:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOP Domain Coordinates for d1clxb_:

Click to download the PDB-style file with coordinates for d1clxb_.
(The format of our PDB-style files is described here.)

Timeline for d1clxb_: