Lineage for d1clxa_ (1clx A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173642Protein Xylanase A, catalytic core [51514] (6 species)
  7. 173660Species Pseudomonas fluorescens [TaxId:294] [51517] (3 PDB entries)
  8. 173661Domain d1clxa_: 1clx A: [28899]

Details for d1clxa_

PDB Entry: 1clx (more details), 1.8 Å

PDB Description: catalytic core of xylanase a

SCOP Domain Sequences for d1clxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clxa_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens}
glasladfpigvavaasggnadiftssarqnivraefnqitaenimkmsymysgsnfsft
nsdrlvswaaqngqtvhghalvwhpsyqlpnwasdsnanfrqdfarhidtvaahfagqvk
swdvvnealfdsaddpdgrgsangyrqsvfyrqfggpeyideafrraraadptaelyynd
fnteengakttalvnlvqrllnngvpidgvgfqmhvmndypsianirqamqkivalsptl
kikiteldvrlnnpydgnssndytnrndcavscagldrqkarykeivqaylevvppgrrg
gitvwgiadpdswlythqnlpdwpllfndnlqpkpayqgvveals

SCOP Domain Coordinates for d1clxa_:

Click to download the PDB-style file with coordinates for d1clxa_.
(The format of our PDB-style files is described here.)

Timeline for d1clxa_: