Lineage for d1b3ya_ (1b3y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082690Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2082708Species Fungus (Penicillium simplicissimum) [TaxId:69488] [51516] (7 PDB entries)
  8. 2082713Domain d1b3ya_: 1b3y A: [28896]
    complexed with xys

Details for d1b3ya_

PDB Entry: 1b3y (more details), 2.45 Å

PDB Description: xylanase from penicillium simplicissimum, complex with xylotetraose
PDB Compounds: (A:) protein (xylanase)

SCOPe Domain Sequences for d1b3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ya_ c.1.8.3 (A:) Xylanase A, catalytic core {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
easvsidakfkahgkkylgtigdqytltkntknpaiikadfgqltpensmkwdatepnrg
qftfsgsdylvnfaqsngklirghtlvwhsqlpgwvssitdkntlisvlknhittvmtry
kgkiyawdvlneifnedgslrnsvfynvigedyvriafetarsvdpnaklyindynldsa
gyskvngmvshvkkwlaagipidgigsqthlgagagsavagalnalasagtkeiaiteld
iagasstdyvnvvnaclnqakcvgitvwgvadpdswrsssspllfdgnynpkaaynaian
al

SCOPe Domain Coordinates for d1b3ya_:

Click to download the PDB-style file with coordinates for d1b3ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b3ya_: