![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (22 proteins) consist of a number of sequence families |
![]() | Protein Xylanase A, catalytic core [51514] (8 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries) |
![]() | Domain d1xas__: 1xas - [28891] CA-atoms only |
PDB Entry: 1xas (more details), 2.6 Å
SCOP Domain Sequences for d1xas__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xas__ c.1.8.3 (-) Xylanase A, catalytic core {Streptomyces lividans} lgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnfssa drvynwavqngkqvrghtlawhsqqpgwmqslsgrplrqamidhingvmahykgkivqwd vvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwaktqa mynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqgapa styanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavlda
Timeline for d1xas__: