Lineage for d1xas__ (1xas -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385031Species Streptomyces lividans [TaxId:1916] [51515] (5 PDB entries)
  8. 385037Domain d1xas__: 1xas - [28891]
    CA-atoms only

Details for d1xas__

PDB Entry: 1xas (more details), 2.6 Å

PDB Description: crystal structure, at 2.6 angstroms resolution, of the streptomyces lividans xylanase a, a member of the f family of beta-1,4-d-glycanses

SCOP Domain Sequences for d1xas__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xas__ c.1.8.3 (-) Xylanase A, catalytic core {Streptomyces lividans}
lgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnfssa
drvynwavqngkqvrghtlawhsqqpgwmqslsgrplrqamidhingvmahykgkivqwd
vvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwaktqa
mynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqgapa
styanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavlda

SCOP Domain Coordinates for d1xas__:

Click to download the PDB-style file with coordinates for d1xas__.
(The format of our PDB-style files is described here.)

Timeline for d1xas__: