Lineage for d1xas__ (1xas -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (13 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) 
Species Streptomyces lividans [TaxId:1916] [51515] (4 PDB entries) 
Domain d1xas__: 1xas - [28891]
Details for d1xas__
PDB Entry: 1xas (more details), 2.6 Å
PDB Description: crystal structure, at 2.6 angstroms resolution, of the streptomyces lividans xylanase a, a member of the f family of beta-1,4-d-glycanses
SCOP Domain Sequences for d1xas__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xas__ c.1.8.3 (-) Xylanase A, catalytic core {Streptomyces lividans}
lgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnfssa
drvynwavqngkqvrghtlawhsqqpgwmqslsgrplrqamidhingvmahykgkivqwd
vvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwaktqa
mynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqgapa
styanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavlda
SCOP Domain Coordinates for d1xas__:
Click to download the PDB-style file with coordinates for d1xas__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xas__:
- d1xas__ first appeared (with stable ids) in SCOP 1.55
- d1xas__ appears in SCOP 1.57
- d1xas__ appears in SCOP 1.61
- d1xas__ appears in the current release, SCOPe 2.08, called d1xasa_
View in 3D