Lineage for d1bhgb3 (1bhg B:329-632)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339836Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1340061Protein beta-Glucuronidase, domain 3 [51512] (1 species)
  7. 1340062Species Human (Homo sapiens) [TaxId:9606] [51513] (2 PDB entries)
  8. 1340068Domain d1bhgb3: 1bhg B:329-632 [28890]
    Other proteins in same PDB: d1bhga1, d1bhga2, d1bhgb1, d1bhgb2

Details for d1bhgb3

PDB Entry: 1bhg (more details), 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d1bhgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhgb3 c.1.8.3 (B:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

SCOPe Domain Coordinates for d1bhgb3:

Click to download the PDB-style file with coordinates for d1bhgb3.
(The format of our PDB-style files is described here.)

Timeline for d1bhgb3: