SCOP 1.73: Domain d1bhgb3: 1bhg B:329-632

Lineage for d1bhgb3 (1bhg B:329-632)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (24 proteins)
   consist of a number of sequence families

6. Protein beta-Glucuronidase, domain 3 [51512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51513] (1 PDB entry)

8. Domain d1bhgb3: 1bhg B:329-632 [28890]
   Other proteins in same PDB: d1bhga1, d1bhga2, d1bhgb1, d1bhgb2
   complexed with man, nag

Details for d1bhgb3

PDB Entry: 1bhg, 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

PDB Compounds: (B:) beta-glucuronidase

SCOP Domain Sequences for d1bhgb3:

Sequence; same for both SEQRES and ATOM records:

>d1bhgb3 c.1.8.3 (B:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

Timeline for d1bhgb3:

• d1bhgb3 first appeared (with stable ids) in SCOP 1.55
  
• d1bhgb3 appears in SCOP 1.71
  
• d1bhgb3 appears in SCOP 1.75
  
• d1bhgb3 appears in the current release, SCOPe 2.08