Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (25 PDB entries) Uniprot P00722 |
Domain d1f4ha5: 1f4h A:334-625 [28885] Other proteins in same PDB: d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha4, d1f4hb1, d1f4hb2, d1f4hb3, d1f4hb4, d1f4hc1, d1f4hc2, d1f4hc3, d1f4hc4, d1f4hd1, d1f4hd2, d1f4hd3, d1f4hd4 complexed with mg |
PDB Entry: 1f4h (more details), 2.8 Å
SCOPe Domain Sequences for d1f4ha5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4ha5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1f4ha5:
View in 3D Domains from same chain: (mouse over for more information) d1f4ha1, d1f4ha2, d1f4ha3, d1f4ha4 |