Lineage for d1f4aa5 (1f4a A:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439538Domain d1f4aa5: 1f4a A:334-625 [28881]
    Other proteins in same PDB: d1f4aa1, d1f4aa2, d1f4aa3, d1f4aa4, d1f4ab1, d1f4ab2, d1f4ab3, d1f4ab4, d1f4ac1, d1f4ac2, d1f4ac3, d1f4ac4, d1f4ad1, d1f4ad2, d1f4ad3, d1f4ad4
    complexed with mg

Details for d1f4aa5

PDB Entry: 1f4a (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (ncs constrained monomer- orthorhombic)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1f4aa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4aa5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1f4aa5:

Click to download the PDB-style file with coordinates for d1f4aa5.
(The format of our PDB-style files is described here.)

Timeline for d1f4aa5: