Lineage for d1ghok5 (1gho K:334-625)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2093778Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 2093786Species Escherichia coli [TaxId:562] [51511] (42 PDB entries)
    Uniprot P00722
  8. 2093941Domain d1ghok5: 1gho K:334-625 [28875]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghop1, d1ghop2, d1ghop3, d1ghop4
    complexed with mg
    complexed with mg

Details for d1ghok5

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (K:) beta-galactosidase

SCOPe Domain Sequences for d1ghok5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghok5 c.1.8.3 (K:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1ghok5:

Click to download the PDB-style file with coordinates for d1ghok5.
(The format of our PDB-style files is described here.)

Timeline for d1ghok5: