Lineage for d1f49f5 (1f49 F:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830795Domain d1f49f5: 1f49 F:334-625 [28870]
    Other proteins in same PDB: d1f49a1, d1f49a2, d1f49a3, d1f49a4, d1f49b1, d1f49b2, d1f49b3, d1f49b4, d1f49c1, d1f49c2, d1f49c3, d1f49c4, d1f49d1, d1f49d2, d1f49d3, d1f49d4, d1f49e1, d1f49e2, d1f49e3, d1f49e4, d1f49f1, d1f49f2, d1f49f3, d1f49f4, d1f49g1, d1f49g2, d1f49g3, d1f49g4, d1f49h1, d1f49h2, d1f49h3, d1f49h4
    complexed with mg
    complexed with mg

Details for d1f49f5

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (F:) beta-galactosidase

SCOPe Domain Sequences for d1f49f5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49f5 c.1.8.3 (F:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1f49f5:

Click to download the PDB-style file with coordinates for d1f49f5.
(The format of our PDB-style files is described here.)

Timeline for d1f49f5: