Lineage for d1f49e5 (1f49 E:334-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18856Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 18857Species Escherichia coli [TaxId:562] [51511] (7 PDB entries)
  8. 18882Domain d1f49e5: 1f49 E:334-625 [28869]
    Other proteins in same PDB: d1f49a1, d1f49a2, d1f49a3, d1f49a4, d1f49b1, d1f49b2, d1f49b3, d1f49b4, d1f49c1, d1f49c2, d1f49c3, d1f49c4, d1f49d1, d1f49d2, d1f49d3, d1f49d4, d1f49e1, d1f49e2, d1f49e3, d1f49e4, d1f49f1, d1f49f2, d1f49f3, d1f49f4, d1f49g1, d1f49g2, d1f49g3, d1f49g4, d1f49h1, d1f49h2, d1f49h3, d1f49h4

Details for d1f49e5

PDB Entry: 1f49 (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

SCOP Domain Sequences for d1f49e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f49e5 c.1.8.3 (E:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1f49e5:

Click to download the PDB-style file with coordinates for d1f49e5.
(The format of our PDB-style files is described here.)

Timeline for d1f49e5: