Lineage for d1bgld5 (1bgl D:334-625)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18856Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 18857Species Escherichia coli [TaxId:562] [51511] (7 PDB entries)
  8. 18865Domain d1bgld5: 1bgl D:334-625 [28860]
    Other proteins in same PDB: d1bgla1, d1bgla2, d1bgla3, d1bgla4, d1bglb1, d1bglb2, d1bglb3, d1bglb4, d1bglc1, d1bglc2, d1bglc3, d1bglc4, d1bgld1, d1bgld2, d1bgld3, d1bgld4, d1bgle1, d1bgle2, d1bgle3, d1bgle4, d1bglf1, d1bglf2, d1bglf3, d1bglf4, d1bglg1, d1bglg2, d1bglg3, d1bglg4, d1bglh1, d1bglh2, d1bglh3, d1bglh4

Details for d1bgld5

PDB Entry: 1bgl (more details), 2.5 Å

PDB Description: beta-galactosidase (chains a-h)

SCOP Domain Sequences for d1bgld5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgld5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1bgld5:

Click to download the PDB-style file with coordinates for d1bgld5.
(The format of our PDB-style files is described here.)

Timeline for d1bgld5: