Lineage for d1dp0d5 (1dp0 D:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173450Domain d1dp0d5: 1dp0 D:334-625 [28848]
    Other proteins in same PDB: d1dp0a1, d1dp0a2, d1dp0a3, d1dp0a4, d1dp0b1, d1dp0b2, d1dp0b3, d1dp0b4, d1dp0c1, d1dp0c2, d1dp0c3, d1dp0c4, d1dp0d1, d1dp0d2, d1dp0d3, d1dp0d4

Details for d1dp0d5

PDB Entry: 1dp0 (more details), 1.7 Å

PDB Description: e. coli beta-galactosidase at 1.7 angstrom

SCOP Domain Sequences for d1dp0d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp0d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1dp0d5:

Click to download the PDB-style file with coordinates for d1dp0d5.
(The format of our PDB-style files is described here.)

Timeline for d1dp0d5: