Lineage for d1aq0a_ (1aq0 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236677Protein Plant beta-glucanases [51507] (2 species)
  7. 236678Species Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId:4513] [51509] (2 PDB entries)
  8. 236679Domain d1aq0a_: 1aq0 A: [28842]

Details for d1aq0a_

PDB Entry: 1aq0 (more details), 2 Å

PDB Description: barley 1,3-1,4-beta-glucanase in monoclinic space group

SCOP Domain Sequences for d1aq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase}
igvcygmsannlpaastvvsmfksngiksmrlyapnqaalqavggtginvvvgapndvls
nlaaspaaaaswvksniqaypkvsfryvcvgnevaggatrnlvpamknvhgalvaaglgh
ikvttsvsqailgvfsppsagsftgeaaafmgpvvqflartnaplmaniypylawaynps
amdmgyalfnasgtvvrdgaygyqnlfdttvdafytamgkhggssvklvvsesgwpsggg
taatpanarfynqhlinhvgrgtprhpgaietyifamfnenqkdsgveqnwglfypnmqh
vypinf

SCOP Domain Coordinates for d1aq0a_:

Click to download the PDB-style file with coordinates for d1aq0a_.
(The format of our PDB-style files is described here.)

Timeline for d1aq0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aq0b_