Lineage for d1aq0a_ (1aq0 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Plant beta-glucanases [51507] (3 species) 
Species Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId:4513] [51509] (2 PDB entries) 
Domain d1aq0a_: 1aq0 A: [28842]
complexed with act
Details for d1aq0a_
PDB Entry: 1aq0 (more details), 2 Å
PDB Description: barley 1,3-1,4-beta-glucanase in monoclinic space group
PDB Compounds: (A:) 1,3-1,4-beta-glucanaseSCOPe Domain Sequences for d1aq0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]}
igvcygmsannlpaastvvsmfksngiksmrlyapnqaalqavggtginvvvgapndvls
nlaaspaaaaswvksniqaypkvsfryvcvgnevaggatrnlvpamknvhgalvaaglgh
ikvttsvsqailgvfsppsagsftgeaaafmgpvvqflartnaplmaniypylawaynps
amdmgyalfnasgtvvrdgaygyqnlfdttvdafytamgkhggssvklvvsesgwpsggg
taatpanarfynqhlinhvgrgtprhpgaietyifamfnenqkdsgveqnwglfypnmqh
vypinf
SCOPe Domain Coordinates for d1aq0a_:
Click to download the PDB-style file with coordinates for d1aq0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aq0a_:
- d1aq0a_ first appeared (with stable ids) in SCOP 1.55
- d1aq0a_ appears in SCOPe 2.07
View in 3D
