Lineage for d1cz1a_ (1cz1 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819173Protein Exo-beta-(1,3)-glucanase [51495] (2 species)
  7. 1819177Species Yeast (Candida albicans) [TaxId:5476] [51496] (4 PDB entries)
  8. 1819180Domain d1cz1a_: 1cz1 A: [28839]

Details for d1cz1a_

PDB Entry: 1cz1 (more details), 1.85 Å

PDB Description: exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution
PDB Compounds: (A:) protein (exo-b-(1,3)-glucanase)

SCOPe Domain Sequences for d1cz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz1a_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOPe Domain Coordinates for d1cz1a_:

Click to download the PDB-style file with coordinates for d1cz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cz1a_: