Lineage for d1cz1a_ (1cz1 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64889Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 64991Protein Exo-beta-(1,3)-glucanase [51505] (1 species)
  7. 64992Species Yeast (Candida albicans) [TaxId:5476] [51506] (1 PDB entry)
  8. 64993Domain d1cz1a_: 1cz1 A: [28839]

Details for d1cz1a_

PDB Entry: 1cz1 (more details), 1.85 Å

PDB Description: exo-b-(1,3)-glucanase from candida albicans at 1.85 a resolution

SCOP Domain Sequences for d1cz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz1a_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans)}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOP Domain Coordinates for d1cz1a_:

Click to download the PDB-style file with coordinates for d1cz1a_.
(The format of our PDB-style files is described here.)

Timeline for d1cz1a_: