Lineage for d1qnoa_ (1qno A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 384889Protein Beta-mannanase [51502] (2 species)
  7. 384894Species Trichoderma reesei [TaxId:51453] [51504] (5 PDB entries)
  8. 384899Domain d1qnoa_: 1qno A: [28838]
    complexed with nag, trs

Details for d1qnoa_

PDB Entry: 1qno (more details), 2 Å

PDB Description: the 3-d structure of a trichoderma reesei b-mannanase from glycoside hydrolase family 5

SCOP Domain Sequences for d1qnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnoa_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei}
assfvtisgtqfnidgkvgyfagtncywcsfltnhadvdstfshisssglkvvrvwgfnd
vntqpspgqiwfqklsatgstintgadglqtldyvvqsaeqhnlkliipfvnnwsdyggi
nayvnafggnattwytntaaqtqyrkyvqavvsryanstaifawelgneprcngcstdvi
vqwatsvsqyvksldsnhlvtlgdeglglstgdgaypytygegtdfaknvqiksldfgtf
hlypdswgtnytwgngwiqthaaaclaagkpcvfeeygaqqnpctneapwqttslttrgm
ggdmfwqwgdtfangaqsnsdpytvwynssnwqclvknhvdain

SCOP Domain Coordinates for d1qnoa_:

Click to download the PDB-style file with coordinates for d1qnoa_.
(The format of our PDB-style files is described here.)

Timeline for d1qnoa_: