Lineage for d1qnqa_ (1qnq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830882Protein Beta-mannanase [51502] (4 species)
  7. 2830891Species Trichoderma reesei [TaxId:51453] [51504] (5 PDB entries)
  8. 2830895Domain d1qnqa_: 1qnq A: [28837]
    complexed with nag, so4, tpt

Details for d1qnqa_

PDB Entry: 1qnq (more details), 1.65 Å

PDB Description: the 3-d structure of a trichoderma reesei b-mannanase from glycoside hydrolase family 5
PDB Compounds: (A:) endo-1,4-b-d-mannanase

SCOPe Domain Sequences for d1qnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnqa_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]}
assfvtisgtqfnidgkvgyfagtncywcsfltnhadvdstfshisssglkvvrvwgfnd
vntqpspgqiwfqklsatgstintgadglqtldyvvqsaeqhnlkliipfvnnwsdyggi
nayvnafggnattwytntaaqtqyrkyvqavvsryanstaifawelgneprcngcstdvi
vqwatsvsqyvksldsnhlvtlgdeglglstgdgaypytygegtdfaknvqiksldfgtf
hlypdswgtnytwgngwiqthaaaclaagkpcvfeeygaqqnpctneapwqttslttrgm
ggdmfwqwgdtfangaqsnsdpytvwynssnwqclvknhvdain

SCOPe Domain Coordinates for d1qnqa_:

Click to download the PDB-style file with coordinates for d1qnqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qnqa_: