Lineage for d3mana_ (3man A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082461Protein Beta-mannanase [51502] (4 species)
  7. 2082464Species Thermobifida fusca [TaxId:2021] [51503] (3 PDB entries)
  8. 2082466Domain d3mana_: 3man A: [28832]
    complexed with bma

Details for d3mana_

PDB Entry: 3man (more details), 1.6 Å

PDB Description: mannohexaose complex of thermomonospora fusca beta-mannanase
PDB Compounds: (A:) protein (beta-mannanase)

SCOPe Domain Sequences for d3mana_:

Sequence, based on SEQRES records: (download)

>d3mana_ c.1.8.3 (A:) Beta-mannanase {Thermobifida fusca [TaxId: 2021]}
atglhvkngrlyeangqefiirgvshphnwypqhtqafadikshgantvrvvlsngvrws
kngpsdvanvislckqnrlicmlevhdttgygeqsgastldqavdywielksvlqgeedy
vlinignepygndsatvaawatdtsaaiqrlraagfehtlvvdapnwgqdwtntmrnnad
qvyasdptgntvfsihmygvysqastitsylehfvnaglpliigefghdhsdgnpdedti
maeaerlklgyigwswsgngggveyldmvynfdgdnlspwgerifygpngiastakeavi
fg

Sequence, based on observed residues (ATOM records): (download)

>d3mana_ c.1.8.3 (A:) Beta-mannanase {Thermobifida fusca [TaxId: 2021]}
atglhvkngrlyeangqefiirgvshphnwypqhtqafadikshgantvrvvlsngvrws
kngpsdvanvislckqnrlicmlevhdttgygeqsgastldqavdywielksvlqgeedy
vlinignepygndsatvaawatdtsaaiqrlraagfehtlvvdapnwgqdwtntmrnnad
qvyasdptgntvfsihmygvysqastitsylehfvnaglpliigefghnpdedtimaeae
rlklgyigwswsgngggveyldmvynfdgdnlspwgerifygpngiastakeavifg

SCOPe Domain Coordinates for d3mana_:

Click to download the PDB-style file with coordinates for d3mana_.
(The format of our PDB-style files is described here.)

Timeline for d3mana_: