SCOPe 2.06: Domain d1bqca_: 1bqc A:

Lineage for d1bqca_ (1bqc A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Beta-mannanase [51502] (4 species)

7. Species Thermobifida fusca [TaxId:2021] [51503] (3 PDB entries)

8. Domain d1bqca_: 1bqc A: [28831]

Details for d1bqca_

PDB Entry: 1bqc, 1.5 Å

PDB Description: beta-mannanase from thermomonospora fusca

PDB Compounds: (A:) protein (beta-mannanase)

SCOPe Domain Sequences for d1bqca_:

Sequence; same for both SEQRES and ATOM records:

>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermobifida fusca [TaxId: 2021]}
atglhvkngrlyeangqefiirgvshphnwypqhtqafadikshgantvrvvlsngvrws
kngpsdvanvislckqnrlicmlevhdttgygeqsgastldqavdywielksvlqgeedy
vlinignepygndsatvaawatdtsaaiqrlraagfehtlvvdapnwgqdwtntmrnnad
qvyasdptgntvfsihmygvysqastitsylehfvnaglpliigefghdhsdgnpdedti
maeaerlklgyigwswsgngggveyldmvynfdgdnlspwgerifygpngiastakeavi
fg

Timeline for d1bqca_:

• d1bqca_ first appeared (with stable ids) in SCOP 1.55
  
• d1bqca_ appears in SCOPe 2.05
  
• d1bqca_ appears in SCOPe 2.07
  
• d1bqca_ appears in the current release, SCOPe 2.08