Lineage for d1egzb_ (1egz B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236635Protein Endoglucanase Cel5a [51499] (3 species)
  7. 236655Species Erwinia chrysanthemi [TaxId:556] [51501] (1 PDB entry)
  8. 236657Domain d1egzb_: 1egz B: [28829]

Details for d1egzb_

PDB Entry: 1egz (more details), 2.3 Å

PDB Description: cellulase cel5 from erwinia chrysanthemi, a family gh 5-2 enzyme
PDB Compounds: (B:)

SCOP Domain Sequences for d1egzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egzb_ c.1.8.3 (B:) Endoglucanase Cel5a {Erwinia chrysanthemi}
sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka

SCOP Domain Coordinates for d1egzb_:

Click to download the PDB-style file with coordinates for d1egzb_.
(The format of our PDB-style files is described here.)

Timeline for d1egzb_: