Lineage for d1egzb_ (1egz B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173586Protein Endoglucanase Cel5a [51499] (3 species)
  7. 173606Species Erwinia chrysanthemi [TaxId:556] [51501] (1 PDB entry)
  8. 173608Domain d1egzb_: 1egz B: [28829]

Details for d1egzb_

PDB Entry: 1egz (more details), 2.3 Å

PDB Description: cellulase cel5 from erwinia chrysanthemi, a family gh 5-2 enzyme
PDB Compounds: (B:)

SCOP Domain Sequences for d1egzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egzb_ c.1.8.3 (B:) Endoglucanase Cel5a {Erwinia chrysanthemi}
sveplsvngnkiyagekaksfagnslfwsnngwggekfytadtvaslkkdwkssivraam
gvqesggylqdpagnkakvervvdaaiandmyaiigwhshsaennrseairffqemarky
gnkpnviyeiyneplqvswsntikpyaeavisairaidpdnliivgtpswsqnvdeasrd
pinakniaytlhfyagthgeslrnkarqalnngialfvtewgtvnadgnggvnqtetdaw
vtfmrdnnisnanwalndknegastyypdsknltesgkkvksiiqswpyka

SCOP Domain Coordinates for d1egzb_:

Click to download the PDB-style file with coordinates for d1egzb_.
(The format of our PDB-style files is described here.)

Timeline for d1egzb_: