Lineage for d1qi0a_ (1qi0 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236635Protein Endoglucanase Cel5a [51499] (3 species)
  7. 236636Species Bacillus agaradhaerens [TaxId:76935] [51500] (16 PDB entries)
  8. 236652Domain d1qi0a_: 1qi0 A: [28827]
    complexed with ca, cbi

Details for d1qi0a_

PDB Entry: 1qi0 (more details), 2.1 Å

PDB Description: endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with cellobiose
PDB Compounds: (A:)

SCOP Domain Sequences for d1qi0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi0a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
as

SCOP Domain Coordinates for d1qi0a_:

Click to download the PDB-style file with coordinates for d1qi0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qi0a_: