Lineage for d1qi0a_ (1qi0 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173586Protein Endoglucanase Cel5a [51499] (3 species)
  7. 173587Species Bacillus agaradhaerens [TaxId:76935] [51500] (16 PDB entries)
  8. 173603Domain d1qi0a_: 1qi0 A: [28827]

Details for d1qi0a_

PDB Entry: 1qi0 (more details), 2.1 Å

PDB Description: endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with cellobiose
PDB Compounds: (A:)

SCOP Domain Sequences for d1qi0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi0a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
as

SCOP Domain Coordinates for d1qi0a_:

Click to download the PDB-style file with coordinates for d1qi0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qi0a_: