SCOP 1.63: Domain d1qhza_: 1qhz A:

Lineage for d1qhza_ (1qhz A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.3: beta-glycanases [51487] (14 proteins)
   consist of a number of sequence families

6. Protein Endoglucanase Cel5a [51499] (3 species)

7. Species Bacillus agaradhaerens [TaxId:76935] [51500] (16 PDB entries)

8. Domain d1qhza_: 1qhz A: [28826]
   complexed with ca

Details for d1qhza_

PDB Entry: 1qhz, 1.95 Å

PDB Description: native tetragonal structure of the endoglucanase cel5a from bacillus agaradhaerens

SCOP Domain Sequences for d1qhza_:

Sequence; same for both SEQRES and ATOM records:

>d1qhza_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
as

Timeline for d1qhza_:

• d1qhza_ first appeared (with stable ids) in SCOP 1.55
  
• d1qhza_ appears in SCOP 1.61
  
• d1qhza_ appears in SCOP 1.65
  
• d1qhza_ appears in the current release, SCOPe 2.08