Lineage for d2a3ha_ (2a3h A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094027Protein Endoglucanase Cel5a [51499] (4 species)
  7. 2094028Species Bacillus agaradhaerens [TaxId:76935] [51500] (21 PDB entries)
    Uniprot O85465 30-329
  8. 2094047Domain d2a3ha_: 2a3h A: [28825]
    complexed with cbi

Details for d2a3ha_

PDB Entry: 2a3h (more details), 2 Å

PDB Description: cellobiose complex of the endoglucanase cel5a from bacillus agaradherans at 2.0 a resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOPe Domain Coordinates for d2a3ha_:

Click to download the PDB-style file with coordinates for d2a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d2a3ha_: