Lineage for d1qi2a_ (1qi2 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305956Family c.1.8.3: beta-glycanases [51487] (16 proteins)
    consist of a number of sequence families
  6. 306129Protein Endoglucanase Cel5a [51499] (3 species)
  7. 306130Species Bacillus agaradhaerens [TaxId:76935] [51500] (17 PDB entries)
  8. 306143Domain d1qi2a_: 1qi2 A: [28824]
    complexed with ca, fct

Details for d1qi2a_

PDB Entry: 1qi2 (more details), 1.75 Å

PDB Description: endoglucanase cel5a from bacillus agaradhaerens in the tetragonal crystal form in complex with 2',4'-dinitrophenyl 2-deoxy-2-fluoro-b- d-cellotrioside

SCOP Domain Sequences for d1qi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi2a_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
as

SCOP Domain Coordinates for d1qi2a_:

Click to download the PDB-style file with coordinates for d1qi2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qi2a_: