Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) |
Family c.1.8.3: beta-glycanases [51487] (22 proteins) consist of a number of sequence families |
Protein Endoglucanase Cel5a [51499] (3 species) |
Species Bacillus agaradhaerens [TaxId:76935] [51500] (17 PDB entries) |
Domain d5a3ha_: 5a3h A: [28823] complexed with ffc |
PDB Entry: 5a3h (more details), 1.82 Å
SCOP Domain Sequences for d5a3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens} svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
Timeline for d5a3ha_: