Lineage for d6a3ha_ (6a3h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819126Protein Endoglucanase Cel5a [51499] (4 species)
  7. 1819127Species Bacillus agaradhaerens [TaxId:76935] [51500] (19 PDB entries)
    Uniprot O85465 30-329
  8. 1819140Domain d6a3ha_: 6a3h A: [28822]
    complexed with fct, gol

Details for d6a3ha_

PDB Entry: 6a3h (more details), 1.68 Å

PDB Description: 2-deoxy-2-fluro-b-d-cellotriosyl/enzyme intermediate complex of the endoglucanase cel5a from bacillus agaradhearans at 1.6 angstrom resolution
PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d6a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOPe Domain Coordinates for d6a3ha_:

Click to download the PDB-style file with coordinates for d6a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d6a3ha_: