Lineage for d4a3ha_ (4a3h A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173586Protein Endoglucanase Cel5a [51499] (3 species)
  7. 173587Species Bacillus agaradhaerens [TaxId:76935] [51500] (16 PDB entries)
  8. 173596Domain d4a3ha_: 4a3h A: [28821]

Details for d4a3ha_

PDB Entry: 4a3h (more details), 1.65 Å

PDB Description: 2',4' dinitrophenyl-2-deoxy-2-fluro-b-d-cellobioside complex of the endoglucanase cel5a from bacillus agaradhaerens at 1.6 a resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d4a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d4a3ha_:

Click to download the PDB-style file with coordinates for d4a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d4a3ha_: