Lineage for d3a3h__ (3a3h -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236477Family c.1.8.3: beta-glycanases [51487] (14 proteins)
    consist of a number of sequence families
  6. 236635Protein Endoglucanase Cel5a [51499] (3 species)
  7. 236636Species Bacillus agaradhaerens [TaxId:76935] [51500] (16 PDB entries)
  8. 236644Domain d3a3h__: 3a3h - [28820]
    complexed with ctr

Details for d3a3h__

PDB Entry: 3a3h (more details), 1.64 Å

PDB Description: cellotriose complex of the endoglucanase cel5a from bacillus agaradherans at 1.6 a resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d3a3h__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3h__ c.1.8.3 (-) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d3a3h__:

Click to download the PDB-style file with coordinates for d3a3h__.
(The format of our PDB-style files is described here.)

Timeline for d3a3h__: