Lineage for d7a3ha_ (7a3h A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305661Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 305956Family c.1.8.3: beta-glycanases [51487] (16 proteins)
    consist of a number of sequence families
  6. 306129Protein Endoglucanase Cel5a [51499] (3 species)
  7. 306130Species Bacillus agaradhaerens [TaxId:76935] [51500] (17 PDB entries)
  8. 306131Domain d7a3ha_: 7a3h A: [28817]
    complexed with eoh, gol

Details for d7a3ha_

PDB Entry: 7a3h (more details), 0.95 Å

PDB Description: native endoglucanase cel5a catalytic core domain at 0.95 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d7a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d7a3ha_:

Click to download the PDB-style file with coordinates for d7a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d7a3ha_: