Lineage for d7a3ha_ (7a3h A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18923Protein Endoglucanase Cel5a [51499] (2 species)
  7. 18924Species Bacillus agaradhaerens [TaxId:76935] [51500] (11 PDB entries)
  8. 18925Domain d7a3ha_: 7a3h A: [28817]

Details for d7a3ha_

PDB Entry: 7a3h (more details), 0.95 Å

PDB Description: native endoglucanase cel5a catalytic core domain at 0.95 angstroms resolution
PDB Compounds: (A:)

SCOP Domain Sequences for d7a3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires

SCOP Domain Coordinates for d7a3ha_:

Click to download the PDB-style file with coordinates for d7a3ha_.
(The format of our PDB-style files is described here.)

Timeline for d7a3ha_: