SCOP 1.75: Domain d1eceb_: 1ece B:

Lineage for d1eceb_ (1ece B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.3: beta-glycanases [51487] (26 proteins)
   consist of a number of sequence families

6. Protein Endocellulase E1 [51497] (1 species)

7. Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)

8. Domain d1eceb_: 1ece B: [28814]
   complexed with glc

Details for d1eceb_

PDB Entry: 1ece, 2.4 Å

PDB Description: acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose

PDB Compounds: (B:) endocellulase e1

SCOP Domain Sequences for d1eceb_:

Sequence; same for both SEQRES and ATOM records:

>d1eceb_ c.1.8.3 (B:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv

Timeline for d1eceb_:

• d1eceb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eceb_ appears in SCOP 1.73
  
• d1eceb_ appears in SCOPe 2.01
  
• d1eceb_ appears in the current release, SCOPe 2.08