Lineage for d1eceb_ (1ece B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18917Protein Endocellulase E1 [51497] (1 species)
  7. 18918Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)
  8. 18920Domain d1eceb_: 1ece B: [28814]

Details for d1eceb_

PDB Entry: 1ece (more details), 2.4 Å

PDB Description: acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose

SCOP Domain Sequences for d1eceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eceb_ c.1.8.3 (B:) Endocellulase E1 {Acidothermus cellulolyticus}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv

SCOP Domain Coordinates for d1eceb_:

Click to download the PDB-style file with coordinates for d1eceb_.
(The format of our PDB-style files is described here.)

Timeline for d1eceb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ecea_