Lineage for d1ecea_ (1ece A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569528Protein Endocellulase E1 [51497] (1 species)
  7. 1569529Species Acidothermus cellulolyticus [TaxId:28049] [51498] (2 PDB entries)
  8. 1569530Domain d1ecea_: 1ece A: [28813]

Details for d1ecea_

PDB Entry: 1ece (more details), 2.4 Å

PDB Description: acidothermus cellulolyticus endocellulase e1 catalytic domain in complex with a cellotetraose
PDB Compounds: (A:) endocellulase e1

SCOPe Domain Sequences for d1ecea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]}
agggywhtsgreildannvpvriaginwfgfetcnyvvhglwsrdyrsmldqikslgynt
irlpysddilkpgtmpnsinfyqmnqdlqgltslqvmdkivayagqiglriildrhrpdc
sgqsalwytssvseatwisdlqalaqrykgnptvvgfdlhnephdpacwgcgdpsidwrl
aaeragnavlsvnpnllifvegvqsyngdsywwggnlqgagqypvvlnvpnrlvysahdy
atsvypqtwfsdptfpnnmpgiwnknwgylfnqniapvwlgefgttlqsttdqtwlktlv
qylrptaqygadsfqwtfwswnpdsgdtggilkddwqtvdtvkdgylapikssifdpv

SCOPe Domain Coordinates for d1ecea_:

Click to download the PDB-style file with coordinates for d1ecea_.
(The format of our PDB-style files is described here.)

Timeline for d1ecea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eceb_