Lineage for d1eqca_ (1eqc A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816056Protein Exo-beta-(1,3)-glucanase [51495] (2 species)
  7. 816060Species Yeast (Candida albicans) [TaxId:5476] [51496] (4 PDB entries)
  8. 816062Domain d1eqca_: 1eqc A: [28811]
    complexed with cts

Details for d1eqca_

PDB Entry: 1eqc (more details), 1.85 Å

PDB Description: exo-b-(1,3)-glucanase from candida albicans in complex with castanospermine at 1.85 a
PDB Compounds: (A:) exo-(b)-(1,3)-glucanase

SCOP Domain Sequences for d1eqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eqca_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvfsggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

SCOP Domain Coordinates for d1eqca_:

Click to download the PDB-style file with coordinates for d1eqca_.
(The format of our PDB-style files is described here.)

Timeline for d1eqca_: