Lineage for d1cena_ (1cen A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082530Protein Endoglucanase CelC [51493] (1 species)
  7. 2082531Species Clostridium thermocellum [TaxId:1515] [51494] (3 PDB entries)
  8. 2082534Domain d1cena_: 1cen A: [28810]
    mutant

Details for d1cena_

PDB Entry: 1cen (more details), 2.3 Å

PDB Description: cellulase (celc) mutant with glu 140 replaced by gln complexed with cellohexaose
PDB Compounds: (A:) cellulase celc

SCOPe Domain Sequences for d1cena_:

Sequence, based on SEQRES records: (download)

>d1cena_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]}
mvsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnv
geykedglsyidrclewckkynlglvldmhhapgyrfqdfktstlfedpnqqkrfvdiwr
flakryinerehiafellnqvvepdstrwnklmlecikaireidstmwlyiggnnynspd
elknladidddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnp
kysfmmelnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyi
slleeydiggavwnykkmdfeiynedrkpvsqelvnilar

Sequence, based on observed residues (ATOM records): (download)

>d1cena_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]}
mvsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnv
geykedglsyidrclewckkynlglvldmhhapgytstlfedpnqqkrfvdiwrflakry
inerehiafellnqvvepdstrwnklmlecikaireidstmwlyiggnnynspdelknla
didddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnpkysfmm
elnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyislleey
diggavwnykkmdfeiynedrkpvsqelvnilar

SCOPe Domain Coordinates for d1cena_:

Click to download the PDB-style file with coordinates for d1cena_.
(The format of our PDB-style files is described here.)

Timeline for d1cena_: