Lineage for d1ceca_ (1cec A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082530Protein Endoglucanase CelC [51493] (1 species)
  7. 2082531Species Clostridium thermocellum [TaxId:1515] [51494] (3 PDB entries)
  8. 2082533Domain d1ceca_: 1cec A: [28809]

Details for d1ceca_

PDB Entry: 1cec (more details), 2.15 Å

PDB Description: a common protein fold and similar active site in two distinct families of beta-glycanases
PDB Compounds: (A:) endoglucanase celc

SCOPe Domain Sequences for d1ceca_:

Sequence, based on SEQRES records: (download)

>d1ceca_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]}
vsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnvg
eykedglsyidrclewckkynlglvldmhhapgyrfqdfktstlfedpnqqkrfvdiwrf
lakryinerehiafellnevvepdstrwnklmlecikaireidstmwlyiggnnynspde
lknladidddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnpk
ysfmmelnnlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyis
lleeydiggavwnykkmdfeiynedrkpvsqelvnilar

Sequence, based on observed residues (ATOM records): (download)

>d1ceca_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]}
vsfkaginlggwisqyqvfskehfdtfitekdietiaeagfdhvrlpfdypiiesddnvg
eykedglsyidrclewckkynlglvldmhhapgstlfedpnqqkrfvdiwrflakryine
rehiafellnevvepdstrwnklmlecikaireidstmwlyiggnnynspdelknladid
ddyivynfhfynpfffthqkahwsesamaynrtvkypgqyegieefvknnpkysfmmeln
nlklnkellrkdlkpaiefrekkkcklycgefgviaiadlesrikwhedyislleeydig
gavwnykkmdfeiynedrkpvsqelvnilar

SCOPe Domain Coordinates for d1ceca_:

Click to download the PDB-style file with coordinates for d1ceca_.
(The format of our PDB-style files is described here.)

Timeline for d1ceca_: